The domain within your query sequence starts at position 1 and ends at position 128; the E-value for the DUF4577 domain shown below is 1.5e-73.
MTHSSQDAGSHGIQEEGRLYVVDSINDLNKLSLCPMESQHLFSLEDKIPNAGTAPGNGRR GLFFVGLLLVLTVSLALVFFAIFLIIQTGNQMEDVSRRLTAEGKDIDDLKKINNMIVKRL NQLDSEQN
DUF4577 |
---|
PFAM accession number: | PF15145 |
---|---|
Interpro abstract (IPR028099): | The function of this family of proteins, has not, as yet, been determined. This family of proteins is found in eukaryotes and includes human coiled-coil domain-containing transmembrane protein C7orf53. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4577