The domain within your query sequence starts at position 10 and ends at position 177; the E-value for the DUF4580 domain shown below is 1.4e-80.
ERVQWTTTIIISSSLKSYEIATALENRSHKVRYSDTLESGSIVFSLSGVAFLLMDAKECM TSAEEIFVTKIEKFINIHQNSFLVLFAPLHGPEEWSLMFRIHQRFLGSNLRILPVHNTVN ALDLMCTIAKTTSKPHIDSICYRMITTKAYIIEQSPVWRTLQKIKGRL
DUF4580 |
---|
PFAM accession number: | PF15162 |
---|---|
Interpro abstract (IPR027857): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 63 and 185 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4580