The domain within your query sequence starts at position 4 and ends at position 131; the E-value for the DUF4581 domain shown below is 9.5e-82.
QQLADVAEKWCSSTPFELIAAEETERRMDFYADPGVSFYVLCPDNGCGDSFHVWSESEDC LPFLQLAQDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPEADH PQMGVSQQ
DUF4581 |
---|
PFAM accession number: | PF15167 |
---|---|
Interpro abstract (IPR027892): | Maturin is required for differentiation during primary neurogenesis [ (PUBMED:24095902) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4581