SMART: Pfam domain DUF4585

The domain within your query sequence starts at position 864 and ends at position 936; the E-value for the DUF4585 domain shown below is 7.5e-27.

RPPGAAPAGKVLVDPESGRYYFVEAPRQPRLRLLFDPESGQYVEVLLPPSPSPSRQPRQP
YAPLALGPGLYPP

DUF4585

PFAM accession number:	PF15232
Interpro abstract (IPR027838):	The function of this domain is yet to be characterised. It is often found in eukaryotes, and is approximately 70 amino acids in length. It has a conserved DPE sequence motif. This domain is putatively thought to lie in the C terminus of the DNA nucleotide repair protein, Xeroderma pigmentosa complementation group A (XPA). The function of XPA is to bind to DNA and repair any mismatched base pairs. In humans, this protein is encoded for in chromosome 5 open reading frame 65. Mutations in the gene lead to myelodysplastic syndromes, where there is inefficient stem cell production in the bone marrow. This suggests that the protein may have a role in forming blood cells [ (PUBMED:19240791) ].

PFAM accession number:

PF15232

Interpro abstract (IPR027838):

The function of this domain is yet to be characterised. It is often found in eukaryotes, and is approximately 70 amino acids in length. It has a conserved DPE sequence motif. This domain is putatively thought to lie in the C terminus of the DNA nucleotide repair protein, Xeroderma pigmentosa complementation group A (XPA). The function of XPA is to bind to DNA and repair any mismatched base pairs. In humans, this protein is encoded for in chromosome 5 open reading frame 65. Mutations in the gene lead to myelodysplastic syndromes, where there is inefficient stem cell production in the bone marrow. This suggests that the protein may have a role in forming blood cells [ (PUBMED:19240791) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4585