The domain within your query sequence starts at position 39 and ends at position 110; the E-value for the DUF4587 domain shown below is 1.5e-23.
QHNRVKEDLLELMMLQNAQMHQLLLGQLVADALNPGPEWPSPPVHTDSHEEQMEEEMEMQ EQEPLVYHHHYL
DUF4587 |
![]() |
---|
PFAM accession number: | PF15248 |
---|---|
Interpro abstract (IPR027904): | This entry represents a domain of unknown function. This domain is found in eukaryotes, and is typically between 64 and 79 amino acids in length. It contains two conserved sequence motifs: QNAQ and HHH. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4587