The domain within your query sequence starts at position 45 and ends at position 172; the E-value for the DUF4592 domain shown below is 1.8e-41.
KNIKFGQRPSNAIPMKKAGSTDASSEEDFVLTSPMEIVTQQDIVPSDTENKSSDTPSSSS PLNLPEAGSDMEEKVAPVKPSRPKRHLSSAGTIESVNLDAIPLAIARLDNSAARHKLAVK PKNQRVSR
DUF4592 |
---|
PFAM accession number: | PF15262 |
---|---|
Interpro abstract (IPR028030): | This domain of unknown function lies to the N terminus of the protein. This domain is found in eukaryotes and contains two completely conserved residues (L and A) that may be functionally important. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4592