The domain within your query sequence starts at position 13 and ends at position 75; the E-value for the DUF4597 domain shown below is 1.3e-44.
MCVSSSNNNHDEAPVLNDKHLSVPNIIITPPTPTGMGLSRDSNKQVWMDELGSYQDDGEL EPE
DUF4597 |
---|
PFAM accession number: | PF15366 |
---|---|
Interpro abstract (IPR027864): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 63 and 76 amino acids in length. There is a conserved TPPTPT sequence motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4597