The domain within your query sequence starts at position 68 and ends at position 175; the E-value for the DUF4598 domain shown below is 1.9e-19.
LLDQVQAFLPQMAQANEKLRREMAAAPAGHFNIENIDETSGNIIQMDVALFEMSRSDSKE EDSPEESSRDSSGDSSESEEDVCVPSEVTIENIKLPNAEGGKGKIEIL
DUF4598 |
![]() |
---|
PFAM accession number: | PF15370 |
---|---|
Interpro abstract (IPR027921): | This uncharacterised family of proteins is found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4598