The domain within your query sequence starts at position 51 and ends at position 139; the E-value for the DUF4599 domain shown below is 2.7e-31.
RRIKQKPSDRTLRVKKRTTKEETEKLQKLLSNMKRQGWLPQEGSVRRLLCSDPSCPICNA MALEIQQLLGVENKKTSSSLLRHSRSFSC
DUF4599 |
![]() |
---|
PFAM accession number: | PF15371 |
---|---|
Interpro abstract (IPR027970): | This domain of unknown function is found in proteins described as spermatogenesis-associated protein 31 (SPATA31). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4599