The domain within your query sequence starts at position 175 and ends at position 277; the E-value for the DUF4606 domain shown below is 3.7e-48.
CTIPDELWNRIYLENTRATLAYIGAITQHISSQCPSCNSKRAELAQSDFLRRRKTLLQSL LLQEKIDEHLHTTDFLTRVGEAHQGFPRLSDDPRIIWKRLTEK
DUF4606 |
 |
|---|
| PFAM accession number: | PF15379 |
|---|---|
| Interpro abstract (IPR027932): | This family is found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4606