The domain within your query sequence starts at position 3 and ends at position 73; the E-value for the DUF4611 domain shown below is 8.6e-29.
LSGEYVGCDGEPQRLRVSCEASGDADPLQSLSAGVVRMKELVAEFFGTLVEQDAQGLAED PDDALDGSRTS
DUF4611 |
 |
|---|
| PFAM accession number: | PF15387 |
|---|---|
| Interpro abstract (IPR027893): | The KEOPS/EKC complex is a tRNA modification complex involved in the biosynthesis of N6-threonylcarbamoyladenosine (t6A). In eukaryotes, KEOPS is composed of OSGEP/Kae1, PRPK/Bud32, TPRKB/Cgi121, LAGE3/Pcc1 and GON7 [ (PUBMED:27903914) ]. This family consists of subunit GON7 from Metazoa. |
| GO component: | EKC/KEOPS complex (GO:0000408) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4611