The domain within your query sequence starts at position 2 and ends at position 119; the E-value for the DUF4612 domain shown below is 1.7e-47.
GCASAKHVATVQNEEEAQRGKSYQNGDVFGDEYRIKPVEEVKYMKNGAEEEQKIAARNQE NLILLSANSVLMVSWAH
DUF4612 |
---|
PFAM accession number: | PF15389 |
---|---|
Interpro abstract (IPR027967): | This protein family is a domain of unknown function, which is found in eukaryotes. Proteins in this family are typically between 109 and 323 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4612