The domain within your query sequence starts at position 435 and ends at position 580; the E-value for the DUF4629 domain shown below is 2.5e-65.
PSDQVRKNKHKSFELLEGDPQAKIQHWDLVEGEGAVGVAGASDRAIDNMAKHPEGKDPKV PPSKNRRARKQRQERPSVPENTSKKTEELKQSRNRVKAEEKPTIPKTKRKRNPPELSQNS FKKPRSNLAMHMLESVQVFHPLGKKI
DUF4629 |
![]() |
---|
PFAM accession number: | PF15442 |
---|---|
Interpro abstract (IPR027898): | This domain is found in eukaryotes, and contains two conserved sequence motifs: MHML and LGKK. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4629