The domain within your query sequence starts at position 131 and ends at position 285; the E-value for the DUF4630 domain shown below is 9.2e-78.
GAALVGVLVADTGADDARAPELQLLETLLRTVFGRQVGGPVQAAAFRPGCPASSLAVQEA ACRALQAAGPGRPAEGAWERPARTGLLTCFSWGPRRQRKNRGVTSSQGPAQEHLQFSEEE LALTPVFPNGDCEDRGNGSRAQDGGVHIPPDPPED
DUF4630 |
---|
PFAM accession number: | PF15443 |
---|---|
Interpro abstract (IPR027868): | This family of proteins is found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4630