The domain within your query sequence starts at position 1 and ends at position 115; the E-value for the DUF4633 domain shown below is 2.2e-59.
MGTSLRSQSFREPRPSYGRLHESQGRSLDGRLHRALSLRLGREKSRSQVPDGTEGLEVSV QERLPGTLGDKEQLIQGQRGGGSRRWLRQYQQHVKRRWRSFVASFPSVTLSQPAS
DUF4633 |
 |
|---|
| PFAM accession number: | PF15464 |
|---|---|
| Interpro abstract (IPR027990): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 94 and 123 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4633