The domain within your query sequence starts at position 1 and ends at position 146; the E-value for the DUF4634 domain shown below is 1.8e-65.
MDVLFIALLVAPLILGQEYDHEEQLEEGDYYQVAYYYYTVTPNYDDFSVNFTVDYSVFES EDRLNRLNKEVTTTEAVETTASSYSLHTELMDPQNPVTTKPVTTEPVTTEPVTTEPQSPN QNDAMSTLQSPVSCFLLWTLLQGGVH
DUF4634 |
---|
PFAM accession number: | PF15465 |
---|---|
Interpro abstract (IPR027957): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 98 and 133 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4634