The domain within your query sequence starts at position 1 and ends at position 73; the E-value for the DUF4635 domain shown below is 1e-35.
MTIQKTGCRGREAAEVVEQRRRSHHCDDRKQTLLALLILVLYLGMGISGSSWEVSGQTKD CNHFQNPVTPQAG
DUF4635 |
 |
|---|
| PFAM accession number: | PF15466 |
|---|---|
| Interpro abstract (IPR027880): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 120 and 154 amino acids in length. There are two conserved sequence motifs: LEQ and DLE. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4635