The domain within your query sequence starts at position 6 and ends at position 111; the E-value for the DUF4637 domain shown below is 2.8e-48.
FASVKTPLWRKEVEDPEAREEDLEDDSSSSSSSSSVEERSDPESATETEEDSRDAEEREA RSVSYSPLRQESSSQQVALLRRSDSSFWGWLSPFALLGGLAAPADR
DUF4637 |
---|
PFAM accession number: | PF15470 |
---|---|
Interpro abstract (IPR029174): | This domain is found in a group of eukaryotic proteins that are typically between 142 and 178 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4637