The domain within your query sequence starts at position 366 and ends at position 509; the E-value for the DUF4655 domain shown below is 2.7e-68.
SPLYPELSTKPSTHVPSAFELTPRPLPPRSLPRYGPDCSWWALLNPKVETPPNHSSFDLE PKSPPPLDPLESFYEMDSTPFCEDLLFQRDKASLPPSPKDSLYRVPLTEVQKTPKYTSKQ PTQGFNAFFLDVSEEMYNRILWWL
DUF4655 |
![]() |
---|
PFAM accession number: | PF15548 |
---|---|
Interpro abstract (IPR027979): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 533 and 570 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4655