The domain within your query sequence starts at position 29 and ends at position 265; the E-value for the DUF4656 domain shown below is 3e-132.
TNDERSQPPPGRRTRRPDPKDPGHHGPESITFISGSAEPANEPPTCCLLWRPWGWDWCRA AFCFRRCRDCLQRCGACVRGCSPCLSAGDPIEGSAEAAWAKEHNGVPPSPDRAPPSRRDG QRLKTSMGSSFSYPDVKLKGIPVYPYRHATSPVPDVDSCCKEPLAEPPPTRHSLPSTFTN SPRGSEEYYSFHESDLDLPEMGSGSMSSREIDVLIFKKLTELFSVHQIDELAKCTSD
DUF4656 |
---|
PFAM accession number: | PF15551 |
---|---|
Interpro abstract (IPR028003): | KDF1 plays a role in the regulation of the epidermis formation during early development. It is required both as an inhibitor of basal cell proliferation and a promoter of differentiation of basal progenitor cell progeny [ (PUBMED:24075906) ]. |
GO process: | keratinocyte development (GO:0003334) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4656