The domain within your query sequence starts at position 1 and ends at position 106; the E-value for the DUF4687 domain shown below is 1.3e-44.
MAQNSVSLSAGDQANRMAHRSSQGDLNPSAMAWAMVSGDSFLVTRLDPNQPGPRPPARPS VRADRRRVPVGGRSRSRSRQGRFSPYPIPGVKLDLLRSVLQQRLVA
DUF4687 |
 |
|---|
| PFAM accession number: | PF15747 |
|---|---|
| Interpro abstract (IPR031487): | This family includes uncharacterised protein C11orf71. Proteins in this family are typically between 76 and 140 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4687