The domain within your query sequence starts at position 1 and ends at position 162; the E-value for the DUF4691 domain shown below is 3.3e-71.
MASEGAKRQPETQNGAAVGLAQVAESLECPGTEECLVPAHETCRSPGEDKCPVGHSLEPE LQEEGIKVGEEGLNAGVEAGEERGPKPTSSIVRPAHGPKRKSEVELPPGVLQKKEEPEGS HSESSLSSKQHKKAKKRKSGGAPVPPAVASASAPAAETLGLE
DUF4691 |
---|
PFAM accession number: | PF15762 |
---|---|
Interpro abstract (IPR031516): | This family of proteins is found in chordates. Proteins in this family are typically between 71 and 317 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4691