The domain within your query sequence starts at position 37 and ends at position 107; the E-value for the DUF4717 domain shown below is 7.8e-39.
LDGDKSQKDKVSSEDQGEEEYEEHFEASSEGEQWQEIDMVQQEDTISQAITLQDHLLDLA FCFNLASIMFF
DUF4717 |
 |
|---|
| PFAM accession number: | PF15838 |
|---|---|
| Interpro abstract (IPR031684): | LLCFC1 (also known as SOF1) and its homologues can be found in eukaryotes. They have two conserved sequence motifs: LLLL and CFNLAS. LLCFC1 is a sperm protein required for sperm-oocyte fusion in mice [ (PUBMED:32393636) ]. |
| GO process: | fusion of sperm to egg plasma membrane involved in single fertilization (GO:0007342) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4717