The domain within your query sequence starts at position 23 and ends at position 179; the E-value for the DUF4732 domain shown below is 4e-83.
GSFLVDLESMEESMSRSLGKPAKSSKQYLRQVISEYEALDRELPCIRKFSEPPSAQPLCL CMETSEDFTHVEVLQALEAELPGAMESGRVNSIRYENMNVICGTAGRRDRWLITVTDFQT RSRLLRSGLTLRGTAYPLVRHDDLLLGDYRLHLRRSL
DUF4732 |
---|
PFAM accession number: | PF15876 |
---|---|
Interpro abstract (IPR031746): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 107 and 201 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4732