The domain within your query sequence starts at position 4 and ends at position 97; the E-value for the DUF4733 domain shown below is 7.7e-50.
AMLGALYPRAGLSLFLFYLILAGALLRPQPQRSQQSVPEEFSAPLELLQPLSGLVDDYGL RPKHPRPGGPRPLLSQAQQRKRDGPNMADYYYDV
DUF4733 |
 |
|---|
| PFAM accession number: | PF15878 |
|---|---|
| Interpro abstract (IPR031748): | This family of uncharacterised proteins is found in chordates. Proteins in this family are typically between 73 and 99 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4733