The domain within your query sequence starts at position 71 and ends at position 121; the E-value for the DUF4748 domain shown below is 2.9e-23.
PMKAVGLAWAIGFPCGILFFVLTKQEVDKDRLKQMKARQNMRVSNTGEYSL
DUF4748 |
---|
PFAM accession number: | PF15932 |
---|---|
Interpro abstract (IPR031833): | This family of proteins is functionally uncharacterised and is found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4748