The domain within your query sequence starts at position 242 and ends at position 348; the E-value for the DUF4757 domain shown below is 2.2e-14.
MSYRRISAIEPKSALPFNRFLPNKSKQPSYVPAPLRKKRPDKHEDNRRSWASPVYTETDG TFSSTQRRTWGPKMETWHTVQETSTSSWCVEEEEEKLTRMPNIVKDD
DUF4757 |
![]() |
---|
PFAM accession number: | PF15949 |
---|---|
Interpro abstract (IPR031865): | This presumed domain is functionally uncharacterised. This domain family is found in eukaryotes. There are two completely conserved residues (W and L) that may be functionally important. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4757