The domain within your query sequence starts at position 250 and ends at position 418; the E-value for the DUF4757 domain shown below is 5.2e-66.
VPMLTPRPYSQPKNSQEVLKTFKVDGKVSMNGEMAPGDEEGKEKEGPAAAAPGPSLTKSQ MFEGVATVHDSPVQVKQGSNSIEINIKKPNSAPQELTAASEETESNGQEDEDGEERPGTG DLEPDSAEPQHFTTTVTRCSPTVALVEFSSNPQLKNEVPEQGQKKPEDE
DUF4757 |
![]() |
---|
PFAM accession number: | PF15949 |
---|---|
Interpro abstract (IPR031865): | This presumed domain is functionally uncharacterised. This domain family is found in eukaryotes. There are two completely conserved residues (W and L) that may be functionally important. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4757