The domain within your query sequence starts at position 714 and ends at position 801; the E-value for the DUF4927 domain shown below is 2e-32.
RQEQLSPKKKENNALLRYLLDRDDPSDVLAKELQPQADSGDSKLSQCSCSTNPSSGQEKD PKIKTETNEEVSGDLDNLDAILGDLTSS
DUF4927 |
 |
|---|
| PFAM accession number: | PF16279 |
|---|---|
| Interpro abstract (IPR032565): | This entry represents a domain found in nuclear receptor coactivators, which are ligand-dependent transcription factors [ (PUBMED:10713439) ]. These receptors can function as molecular switches [ (PUBMED:10713439) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4927