The domain within your query sequence starts at position 286 and ends at position 389; the E-value for the DUF5009 domain shown below is 2.4e-10.
WYFKHSSWNGLTVADLVFPWFVFIMGTSIFLSMTSILQRGCSKLKLLGKIVWRSFLLICI GVIIVNPNYCLGPLSWDKVRIPGVLQRLGVTYFVVAVLEFFFWK
DUF5009 |
![]() |
---|
PFAM accession number: | PF16401 |
---|---|
Interpro abstract (IPR032176): | Proteins containing this DUF5009 domain are not characterised. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF5009