SMART: Pfam domain DUF563

The domain within your query sequence starts at position 162 and ends at position 395; the E-value for the DUF563 domain shown below is 1.7e-25.

DNLMHVFHDDLLPLFYTLRQFPGLAQEARLFFMEGWGEGAHFDLYKLLSPKQPLLRAQLK
TLGRLLCFSHAFVGLSKVTTWYQYGFVQPQGPKANILVSGNEIRQFTRFMTERLNVSHAG
APLGEEYILVFSRTQNRLILNEAELLLELAQEFQMKTVTVSLEDHTFADVVRLVSNASML
VSMHGAQLVTALFLPRGATVVELFPYAVNPDHYTPYKTLATLPGMDLQYVAWRN

DUF563

PFAM accession number:	PF04577
Interpro abstract (IPR007657):	Glycosyltransferase 61 family members are further processed into a mature form. Proteins in this family includes O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 (POMGnT2, also known as EOGTL) [ (PUBMED:23929950) ] and EGF domain-specific O-linked N-acetylglucosamine transferase (EOGT) [ (PUBMED:23671640) ]. This entry also includes plant beta-(1,2)-xylosyltransferase [ (PUBMED:10781814) ].
GO function:	transferase activity, transferring glycosyl groups (GO:0016757)

PFAM accession number:

PF04577

Interpro abstract (IPR007657):

Glycosyltransferase 61 family members are further processed into a mature form. Proteins in this family includes O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 (POMGnT2, also known as EOGTL) [ (PUBMED:23929950) ] and EGF domain-specific O-linked N-acetylglucosamine transferase (EOGT) [ (PUBMED:23671640) ].

This entry also includes plant beta-(1,2)-xylosyltransferase [ (PUBMED:10781814) ].

GO function:

transferase activity, transferring glycosyl groups (GO:0016757)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF563