The domain within your query sequence starts at position 162 and ends at position 395; the E-value for the DUF563 domain shown below is 1.7e-25.
DNLMHVFHDDLLPLFYTLRQFPGLAQEARLFFMEGWGEGAHFDLYKLLSPKQPLLRAQLK TLGRLLCFSHAFVGLSKVTTWYQYGFVQPQGPKANILVSGNEIRQFTRFMTERLNVSHAG APLGEEYILVFSRTQNRLILNEAELLLELAQEFQMKTVTVSLEDHTFADVVRLVSNASML VSMHGAQLVTALFLPRGATVVELFPYAVNPDHYTPYKTLATLPGMDLQYVAWRN
DUF563 |
![]() |
---|
PFAM accession number: | PF04577 |
---|---|
Interpro abstract (IPR007657): | Glycosyltransferase 61 family members are further processed into a mature form. Proteins in this family includes O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 (POMGnT2, also known as EOGTL) [ (PUBMED:23929950) ] and EGF domain-specific O-linked N-acetylglucosamine transferase (EOGT) [ (PUBMED:23671640) ]. This entry also includes plant beta-(1,2)-xylosyltransferase [ (PUBMED:10781814) ]. |
GO function: | transferase activity, transferring glycosyl groups (GO:0016757) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF563