The domain within your query sequence starts at position 60 and ends at position 183; the E-value for the DUF667 domain shown below is 5e-26.
SAAWQHPFLNVFRHFRVDEWKRSSKEGDVAVVTDKVLKSAVYRIRGSVSASNYIQLPRTS TQSLGLTGRYLYVLFRPVPTKHFVIHLDVSTEDGQVIRVSFSNLFKEFKSSTTWLQFPFV FETK
DUF667 |
![]() |
---|
PFAM accession number: | PF05018 |
---|---|
Interpro abstract (IPR007714): | This domain is characteristic of cilia- and flagella-associated protein 20 (CFA20). CFA20 is a cilium- and flagellum-specific protein that plays a role in axonemal structure organisation and motility [ (PUBMED:20118210) (PUBMED:24574454) ]. In Chlamydomonas reinhardtii, it stabilises outer doublet microtubules (DMTs) of the axoneme and may work as a scaffold for intratubular proteins, such as tektin and PACRG, to produce the beak structures in DMT1 [ (PUBMED:24259666) (PUBMED:24574454) ]. Other proteins contain a domain with homology to CFA20. WDR90/POC16 contains such a domain in its N terminus, followed by a large C-terminal domain with multiple WD40 repeats [ (PUBMED:24574454) ]. This domain is also present in the N terminus of uncharacterised protein C3orf67. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF667