The domain within your query sequence starts at position 1022 and ends at position 1218; the E-value for the DUF676 domain shown below is 6.7e-62.
SEDGVHLIVCVHGLDGNSADLRLVKTYIELGLPGGRVDFLMSERNQNDTFADFDCMTDRL LDEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLSKLHTFLSLSGPHLGTL YNSSALVNTGLWFMQKWKKSGSLLQLTCRDHSDPRQTFLYKLSNKAGLHYFKNVVLVGSL QDRYVPYHSARIEMCKT
DUF676 |
![]() |
---|
PFAM accession number: | PF05057 |
---|---|
Interpro abstract (IPR007751): | This domain, whose function is unknown, is found within a group of putative lipases. Proteins containing this domain include YOR059C (Lpl1) from budding yeasts. Lpl1 has been identified as a phospholipase B [ (PUBMED:25014274) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF676