The domain within your query sequence starts at position 71 and ends at position 195; the E-value for the DUF716 domain shown below is 6.1e-36.
RCVVLEQCAQALSMYLFLPLMVSHMQDTEGVELQLHMLLIQAMFLLALVETIELWAPNVL LIWMLKAFLYVVTGSWLMQIGFMLYKPISGYKWLDEDKNDVAFATTFFCWHVVSGAFLMI SAYGV
DUF716 |
![]() |
---|
PFAM accession number: | PF04819 |
---|---|
Interpro abstract (IPR006904): | These sequences are a family of uncharacterised hypothetical proteins restricted to eukaryotes ( Q9SLW7 ) represents a sequence from Nicotiana tabacum (Common tobacco) which is up regulated in response to TMV infection. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF716