The domain within your query sequence starts at position 1 and ends at position 70; the E-value for the DUF776 domain shown below is 4e-38.
MKSEAKDGEEESLQTAFKKLRVDASGSIISLSVGEGPSVRASARTAADDTKPKTMCASKD SWHGSTRKSS
DUF776 |
 |
|---|
| PFAM accession number: | PF05604 |
|---|---|
| Interpro abstract (IPR008494): | This family consists of several highly related Mus musculus and Homo sapiens proteins of unknown function. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF776