The domain within your query sequence starts at position 1 and ends at position 172; the E-value for the DUF938 domain shown below is 1.6e-74.
MMMAAAAERNKEPILSVLRQYVDPAQRCVRVLEVASGSGQHAAHFAQAFPNAEWQPSDVD QRCLDSIAATTRAQGLSNVKAPLYLDVTWEWEQWGGIPPRSLDLLLCINMIHISPLNCTE GLFRAAGHLLKTKAVLITYGPYAVNGKISPQSNVDFDLTLRCRFSDMEDREG
DUF938 |
---|
PFAM accession number: | PF06080 |
---|---|
Interpro abstract (IPR010342): | This family consists of several hypothetical proteins from both prokaryotes and eukaryotes. Chordate members are known as 'methyltransferase-like 26'. The function of this family is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF938