The domain within your query sequence starts at position 158 and ends at position 328; the E-value for the Dala_Dala_lig_C domain shown below is 7.9e-13.
IAIAAGVPVVPGTDSPISSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENY TRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEI APATHLDPQLRSRLTSDSVKLAKQVGYENAGTVEFLVDKHGKHYFIEVNSR
Dala_Dala_lig_C |
![]() |
---|
PFAM accession number: | PF07478 |
---|---|
Interpro abstract (IPR011095): | This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme EC 6.3.2.4 . D-Alanine is one of the central molecules of the cross-linking step of peptidoglycan assembly. There are three enzymes involved in the D-alanine branch of peptidoglycan biosynthesis: the pyridoxal phosphate-dependent D-alanine racemase (Alr), the ATP-dependent D-alanine: D-alanine ligase (Ddl), and the ATP-dependent D-alanine:D-alanine-adding enzyme (MurF) [ (PUBMED:12499203) ]. |
GO function: | D-alanine-D-alanine ligase activity (GO:0008716) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dala_Dala_lig_C