The domain within your query sequence starts at position 40 and ends at position 145; the E-value for the DcpS domain shown below is 4.2e-32.
RLPFSGFRVQKVLRESARDKIIFLHGKVNEDSGDTHGEDAVVILEKTPFQVEHVAQLLTG SPELKLQFSNDIYSTYNLFPPRHLSDIKTTVVYPATEKHLQKYMRQ
DcpS |
 |
|---|
| PFAM accession number: | PF05652 |
|---|---|
| Interpro abstract (IPR008594): | This entry represents scavenger mRNA decapping enzymes, such as Dcp2 and DcpS. DcpS is a scavenger pyrophosphatase that hydrolyses the residual cap structure following 3' to 5' mRNA degradation. DcpS uses cap dinucleotides or capped oligonucleotides as substrate to release m(7)GMP (N7-methyl GMP), while Dcp2 uses capped mRNA as substrate in order to hydrolyse the cap to release m(7)GDP (N7-methyl GDP) [ (PUBMED:16246173) ]. The association of DcpS with 3' to 5' exonuclease exosome components suggests that these two activities are linked and there is a coupled exonucleolytic decay-dependent decapping pathway. The family contains a histidine triad (HIT) sequence with three histidines separated by hydrophobic residues [ (PUBMED:16001405) ]. The central histidine within the DcpS HIT motif is critical for decapping activity and defines the HIT motif as a new mRNA decapping domain, making DcpS the first member of the HIT family of proteins with a defined biological function. This family is related to ( IPR001310 ). |
| GO process: | deadenylation-dependent decapping of nuclear-transcribed mRNA (GO:0000290) |
| GO function: | hydrolase activity (GO:0016787) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DcpS