The domain within your query sequence starts at position 17 and ends at position 106; the E-value for the Dimerisation2 domain shown below is 1.1e-29.
ALMDLAHGFMASQVLFAGCALRVFDAAALGPVDAAALARSSGLSPRGTRLLLDACAGLGL LGRRRGAGPRGPAYTNSPLASTFLVAGSPL
Dimerisation2 |
 |
|---|
| PFAM accession number: | PF16864 |
|---|---|
| Interpro abstract (IPR031725): | This domain, found in some O-methyltransferases, functions as a dimerisation domain. It is found in acetylserotonin O-methyltransferase (ASMT) [ (PUBMED:22775292) ] among others. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dimerisation2