SMART: Pfam domain Diphthamide

The domain within your query sequence starts at position 62 and ends at position 276; the E-value for the Diphthamide_syn domain shown below is 1.1e-79.

MPEGLLLFACTIVDILERFTEAEVMVMGDVTYGACCVDDFTARALGVDFLVHYGHSCLVP
MDTSVQDFRVLYVFVDIRIDTAHLLDSVRLTFTPGSSLALVSTIQFVSTLQAAAQELKAD
YHISVPQCKPLSPGEILGCTSPRLSKEVEAVVYLGDGRFHLESVMIANPNIPAYRYDPYG
KVLSREYYDHQRMQATRQEAIAAARSAKSWGLIL

Diphthamide_syn

PFAM accession number:	PF01866
Interpro abstract (IPR016435):	Archaeal and eukaryotic translation elongation factor 2 contain a unique posttranslationally modified histidine residue called diphthamide, the target of the diphtheria toxin. Diphtheria toxin inhibits eukaryotic protein synthesis by ADP-ribosylating diphthamide in EF2 [ (PUBMED:15485916) ]. Members of this family include DPH1 and DPH2, which are involved in the first step of diphthamide synthesis [ (PUBMED:15485916) ]. Archaeal DPHs are more similar to eukaryotic DPH1 than to DPH2 [ (PUBMED:20559380) ].

PFAM accession number:

PF01866

Interpro abstract (IPR016435):

Archaeal and eukaryotic translation elongation factor 2 contain a unique posttranslationally modified histidine residue called diphthamide, the target of the diphtheria toxin. Diphtheria toxin inhibits eukaryotic protein synthesis by ADP-ribosylating diphthamide in EF2 [ (PUBMED:15485916) ].

Members of this family include DPH1 and DPH2, which are involved in the first step of diphthamide synthesis [ (PUBMED:15485916) ]. Archaeal DPHs are more similar to eukaryotic DPH1 than to DPH2 [ (PUBMED:20559380) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Diphthamide_syn