The domain within your query sequence starts at position 62 and ends at position 276; the E-value for the Diphthamide_syn domain shown below is 1.1e-79.
MPEGLLLFACTIVDILERFTEAEVMVMGDVTYGACCVDDFTARALGVDFLVHYGHSCLVP MDTSVQDFRVLYVFVDIRIDTAHLLDSVRLTFTPGSSLALVSTIQFVSTLQAAAQELKAD YHISVPQCKPLSPGEILGCTSPRLSKEVEAVVYLGDGRFHLESVMIANPNIPAYRYDPYG KVLSREYYDHQRMQATRQEAIAAARSAKSWGLIL
Diphthamide_syn |
---|
PFAM accession number: | PF01866 |
---|---|
Interpro abstract (IPR016435): | Archaeal and eukaryotic translation elongation factor 2 contain a unique posttranslationally modified histidine residue called diphthamide, the target of the diphtheria toxin. Diphtheria toxin inhibits eukaryotic protein synthesis by ADP-ribosylating diphthamide in EF2 [ (PUBMED:15485916) ]. Members of this family include DPH1 and DPH2, which are involved in the first step of diphthamide synthesis [ (PUBMED:15485916) ]. Archaeal DPHs are more similar to eukaryotic DPH1 than to DPH2 [ (PUBMED:20559380) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Diphthamide_syn