The domain within your query sequence starts at position 108 and ends at position 330; the E-value for the DnaJ_C domain shown below is 9.7e-35.
VVHQLSVTLEDLYNGITKKLALQKNVICEKCEGIGGKKGSVEKCPLCKGRGMQVHIQQIG PGMVQQIQTVCIECKGQGERINPKDRCENCSGAKVTREKKIIEVHVEKGMKDGQKILFHG EGDQEPELDPGDVIIVLDQKDHSVFQRRGQDLIMKMKIQLSEALCGFKKTIKTLDDRVLV ISSKSGEVIKHGDLKCIRNEGMPIYKAPLEKGVMIIQFLVVFP
DnaJ_C |
---|
PFAM accession number: | PF01556 |
---|---|
Interpro abstract (IPR002939): | Molecular chaperones are a diverse family of proteins that function to protect proteins in the intracellular milieu from irreversible aggregation during synthesis and in times of cellular stress. The bacterial molecular chaperone DnaK is an enzyme that couples cycles of ATP binding, hydrolysis, and ADP release by an N-terminal ATP-hydrolizing domain to cycles of sequestration and release of unfolded proteins by a C-terminal substrate binding domain. Dimeric GrpE is the co-chaperone for DnaK, and acts as a nucleotide exchange factor, stimulating the rate of ADP release 5000-fold [ (PUBMED:8016869) ]. DnaK is itself a weak ATPase; ATP hydrolysis by DnaK is stimulated by its interaction with another co-chaperone, DnaJ. Thus the co-chaperones DnaJ and GrpE are capable of tightly regulating the nucleotide-bound and substrate-bound state of DnaK in ways that are necessary for the normal housekeeping functions and stress-related functions of the DnaK molecular chaperone cycle. Besides stimulating the ATPase activity of DnaK through its J-domain, DnaJ also associates with unfolded polypeptide chains and prevents their aggregation [ (PUBMED:15063739) ]. Thus, DnaK and DnaJ may bind to one and the same polypeptide chain to form a ternary complex. The formation of a ternary complex may result in cis-interaction of the J-domain of DnaJ with the ATPase domain of DnaK. An unfolded polypeptide may enter the chaperone cycle by associating first either with ATP-liganded DnaK or with DnaJ. DnaK interacts with both the backbone and side chains of a peptide substrate; it thus shows binding polarity and admits only L-peptide segments. In contrast, DnaJ has been shown to bind both L- and D-peptides and is assumed to interact only with the side chains of the substrate. This domain consists of the C-terminal region of the DnaJ protein. The function of this domain is unknown. It is found associated with IPR001623 and IPR001305 . DnaJ is a chaperone associated with the Hsp70 heat-shock system involved in protein folding and renaturation after stress. The two C-terminal domains CTDI and this, CTDII, are necessary for maintaining the J-domains in their specific relative positions [ (PUBMED:22011374) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DnaJ_C