The domain within your query sequence starts at position 5 and ends at position 103; the E-value for the DoxX domain shown below is 9e-9.
VGVLRVLLGVFFALTGAAKLFQVSAPVSQQMRALFEQFAEVFPLKVFGYQPDPISYQTAV GWLELLAGLLLVVGPPVLQEISNVLLILLMMGAVFTLVV
DoxX |
 |
|---|
| PFAM accession number: | PF07681 |
|---|---|
| Interpro abstract (IPR032808): | This is a family of uncharacterised proteins known as DoxX. The family includes transmembrane protein TMEM35. The function of TMEM35 is unknown, but a peptide derived from the TMEM35 gene may be involved in modulating neurite outgrowth after sodium depletion [ (PUBMED:20685870) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DoxX