The domain within your query sequence starts at position 114 and ends at position 150; the E-value for the Dppa2_A domain shown below is 2.4e-3.

LRNVPDSAKDSRLKTAHKKMKTEQGEESEVTVPLEMV

Dppa2_A

Dppa2_A
PFAM accession number:PF14049
Interpro abstract (IPR025892):

Developmental pluripotency associated genes (Dppa) in lower vertebrates have remained undetected until the discovery of a Dppa homologue in Xenopus laevis [ (PUBMED:19772919) ]. This entry represents a central domain of Dppa 2/4.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dppa2_A