The domain within your query sequence starts at position 166 and ends at position 211; the E-value for the Dppa2_A domain shown below is 1.6e-10.
FYEEVSTTVVTTPATEAMLASWARIASNAKKYEAVPADASSSSSEV
Dppa2_A |
---|
PFAM accession number: | PF14049 |
---|---|
Interpro abstract (IPR025892): | Developmental pluripotency associated genes (Dppa) in lower vertebrates have remained undetected until the discovery of a Dppa homologue in Xenopus laevis [ (PUBMED:19772919) ]. This entry represents a central domain of Dppa 2/4. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dppa2_A