The domain within your query sequence starts at position 1 and ends at position 42; the E-value for the Dpy-30 domain shown below is 7.6e-23.

MESRYLQKCLGTCLTQGLTEVARVRPLDPIEYLAFWLYKHKE

Dpy-30

Dpy-30
PFAM accession number:PF05186
Interpro abstract (IPR007858):

This motif is about 40 residues long and is probably formed of two alpha-helices. It is found in the Dpy-30 proteins, hence the motifs name. Dpy-30 from Caenorhabditis elegans is an essential component of dosage compensation machinery and loss of dpy-30 activity results in XX-specific lethality; in XO animals, Dpy-30 is required for developmental processes other than dosage compensation [ (PUBMED:7588066) ]. In yeast, the homologue of DPY-30, Saf19p, functions as part of the Set1 complex that is necessary for the methylation of histone H3 at lysine residue 4; Set1 is a key part of epigenetic developmental control [ (PUBMED:11752412) ]. There is also a human homologue of Dpy-30 [ (PUBMED:16260194) ]. This Dpy-30 region may be a dimerisation motif analogous that found in the cAMP-dependent protein kinase regulator, type II PKA, R subunit IPR003117 .

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dpy-30