The domain within your query sequence starts at position 4 and ends at position 132; the E-value for the Drc1-Sld2 domain shown below is 2.8e-14.
LATVRARLQEWERAFARLHGRRPAKGDVEAAPEETRALYREYRNLKQAVRQADDRHRVLE QSLAEAAEEAQEPSCWGPHLSRAATQNTQSMPKQSLLSSVQDYGKRLKANLKNTTQTGPT QSRKLQLQK
Drc1-Sld2 |
![]() |
---|
PFAM accession number: | PF11719 |
---|---|
Interpro abstract (IPR021110): | Genome duplication is precisely regulated by cyclin-dependent kinases CDKs, which bring about the onset of S phase by activating replication origins and then prevent relicensing of origins until mitosis is completed. The optimum sequence motif for CDK phosphorylation is S/T-P-K/R-K/R, and Drc1-Sld2 is found to have at least 11 potential phosphorylation sites. Drc1 is required for DNA synthesis and S-M replication checkpoint control. Drc1 associates with Cdc2 and is phosphorylated at the onset of S phase when Cdc2 is activated. Thus Cdc2 promotes DNA replication by phosphorylating Drc1 and regulating its association with Cut5 [ (PUBMED:11937031) ]. Sld2 and Sld3 represent the minimal set of S-CDK substrates required for DNA replication [ (PUBMED:17167415) ]. This entry also includes ATP-dependent DNA helicase Q4, which may be involved in chromosome segregation and has been associated with various diseases. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Drc1-Sld2