The domain within your query sequence starts at position 6 and ends at position 170; the E-value for the Dynactin_p22 domain shown below is 2.8e-61.

DVQRLQSRVEELERWVYGPGGTRGSRKVADGLVKVQVALGNIASKRERVKILYKKIEDLI
KYLDPEYIDRIAIPEASKLQFILAEEQFILSQVALLEQVNALVPVLDSASIKAVPEHAAR
LQRLAQIHIQQQDQCVAITEESKALLEGYNKTTMLLSKQFVQWDE

Dynactin_p22

 Dynactin_p22
PFAM accession number:PF07426
Interpro abstract (IPR009991):

DCTN3 is the smallest subunit of dynactin, a complex that binds to cytoplasmic dynein and is a required activator for cytoplasmic dynein-mediated vesicular transport. Dynactin localises to the cleavage furrow and to the midbodies of dividing cells, suggesting that it may function in cytokinesis [ (PUBMED:9722614) ].

GO process:cytoskeleton-dependent cytokinesis (GO:0061640)
GO component:dynactin complex (GO:0005869)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dynactin_p22