The domain within your query sequence starts at position 16 and ends at position 400; the E-value for the Dynamitin domain shown below is 7.1e-129.
EPDVYETSDLPEDDQAEFDAEELSSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDRIGK TKRTGYESGDYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKIKTTVKESATEEKLTP VVLAKQLAALKQQLVASHLEKLLGPDAAINLADPDGALAKRLLLQLEATKSSKGSSGGKA TAGAPPDSSLVTYELHSRPEQDKFSQAAKVAELEKRLTELEATVRCDQDAQNPLSAGLQG ACLMETVELLQAKVSALDLAVLDQVEARLQSVLGKVNEIAKHKASVEDADTQNKVHQLYE TIQRWSPVASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMMASSLKDNTALLTQV QTTMRENLATVEGNFASIDARMKRL
Dynamitin |
---|
PFAM accession number: | PF04912 |
---|---|
Interpro abstract (IPR028133): | Dynactin is a multiprotein complex necessary for the function of microtubule motor protein dynein. The dynein-dynactin complex is involved in a variety of cellular events, including membrane vesicle transport, mitotic spindle assembly and centrosome separation [ (PUBMED:19935668) (PUBMED:9522459) (PUBMED:10047518) ]. Dynamitin (dynactin subunit 2, DCTN2) is a subunit of the dynactin complex. In Saccharomyces cerevisiae it is also known as Jnm1. Dynactin contains two distinct structural domains: a projecting sidearm that interacts with dynein and an actin-like minifilament backbone that is thought to bind cargo. Dynamitin holds together both structural domains [ (PUBMED:10525537) ]. Dynamitin is implicated in cell adhesion by binding to macrophage-enriched myristoylated alanine-rice C kinase substrate (MacMARCKS) [ (PUBMED:12082093) ]. In mice, DCTN2 is involved in anchoring microtubules to centrosomes and may play a role in synapse formation during brain development [ (PUBMED:9144527) ]. |
GO process: | microtubule-based process (GO:0007017) |
GO component: | dynactin complex (GO:0005869) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dynamitin