The domain within your query sequence starts at position 1 and ends at position 89; the E-value for the Dynein_light domain shown below is 3.8e-49.

MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGR
NFGSYVTHETKHFIYFYLGQVAILLFKSG

Dynein_light

Dynein_light
PFAM accession number:PF01221
Interpro abstract (IPR001372):

Dynein is a multisubunit microtubule-dependent motor enzyme that acts as the force generating protein of eukaryotic cilia and flagella. The cytoplasmic isoform of dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.

Dynein is composed of a number of ATP-binding large subunits (see IPR004273 ), intermediate size subunits and small subunits. Among the small subunits, there is a family of highly conserved proteins which make up this family [ (PUBMED:7744782) (PUBMED:8628263) ].

Both type 1 (DLC1) and 2 (DLC2) dynein light chains have a similar two-layer alpha-beta core structure consisting of beta-alpha(2)-beta-X-beta(2) [ (PUBMED:10426949) (PUBMED:14561217) ].

GO process:microtubule-based process (GO:0007017)
GO component:dynein complex (GO:0030286)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dynein_light