The domain within your query sequence starts at position 43 and ends at position 163; the E-value for the Dzip-like_N domain shown below is 3.7e-46.

FQFRPRLESVDWRRLSAIDVDKVAGAVDVLTLQENIMNITFCKLEDEKCPHCQSGVDPVL
LKLIRLAQLTIEYLMHSQEFLTSQLNLVEERLRLSLLDYEQSKQLLTKQAGEIKLLKEEC
K

Dzip-like_N

 Dzip-like_N
PFAM accession number:PF13815
Interpro abstract (IPR032714):

This entry represents the N-terminal region of the zinc finger protein Dzip1. Zebrafish Dzip1 acts as a permissive factor that is required for the proper regulation of Hedgehog (Hh) target genes in response to Hh signals [ (PUBMED:15115751) ]. It is required for establishment of left-right asymmetry during embryogenesis and has a role in primary cilium formation [ (PUBMED:19852954) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Dzip-like_N